PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g004514m
Common NameCISIN_1g004514mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family GRAS
Protein Properties Length: 748aa    MW: 84967.6 Da    PI: 6.4031
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g004514mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS395.36.5e-1213747451374
               GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                        l++lL++cA+av+++d + a+++L+++++++sp gd +qRla++f+ +L+arla+++s++yk +  ++ts    ++ l+a++l+  ++P+ k
  orange1.1g004514m 374 LRSLLIHCAQAVAADDRRSAHEFLKQIRQHSSPFGDGNQRLAKCFADGLEARLAGTGSQIYKGFVNKRTS---AADILKAYQLYLAACPFRK 462
                        689*************************************************************999998...9****************** PP

               GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlv 182
                        +s++taN++I+  ++++ r+HiiDf+i +G+QWp+++q ++ Rp+gpp+lRiTg++ p++g   +e++eetg+rLa++A+ ++vpfe+n+ +
  orange1.1g004514m 463 LSNFTANKTIMSLAQNSMRLHIIDFGILYGFQWPTFIQRISMRPGGPPKLRITGIEFPQPGfrPAERVEETGRRLADYAKDFNVPFEYNA-I 553
                        ************************************************************9*****************************.7 PP

               GRAS 183 akrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                        akr+++++leeL+++++E+l+Vn+ ++ ++llde+ +++s r+ +L+++++++P+++++   +  +n++ F++rf eal ++sa+fd+le+ 
  orange1.1g004514m 554 AKRWDTIQLEELKIDRDEVLVVNCLYRAKNLLDETIAVDSSRNIFLNFIRKINPHMFIHGITNGAYNAPFFVTRFREALFHFSAMFDMLETI 645
                        ******************************************************************************************** PP

               GRAS 275 lpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrp 366
                        +pre++er+++E+ ++gre+ nvvaceg er+er et+++W+ r  +aGF ++pl+ +++k a   +r  + + + ++e++ +l++gWk+r 
  orange1.1g004514m 646 VPREDRERMVIEKDIFGREALNVVACEGWERVERPETYKQWQVRNLRAGFVQLPLDRDIVKRATDRVRSGYHKDFVIDEDNRWLLQGWKGRI 737
                        *********************************************************************99888****************** PP

               GRAS 367 LvsvSaWr 374
                        ++++SaW+
  orange1.1g004514m 738 IYALSAWK 745
                        *******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.637348725IPR005202Transcription factor GRAS
PfamPF035142.2E-118374745IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 748 aa     Download sequence    Send to blast
MDPRLRGFPG SGNGIQLSNQ PVSVFPNQNL VAGRFENIFL DQRFRDCRYR QPDPTPINVV  60
SSSTVNHEED SPEDCDFSDA VLRYINQMLM EEDIEEKNCM LQESLDLQAA EKSFYDVLGK  120
KYPPSPDHSL TYFHQNGESP DGDTSRNLHG YIYGGSDVSS YLIDNNFIQN SGEYFNSQLQ  180
SLPLSTMPQS SYSSSNSVIT SVDGLVDSPS SSLQLPDWNN ESQSIWQFRK GVEEANKFLP  240
SENELFVNLE ANRLSSWVPK GETNEVAVKE EKEEVEDVSS NGSRGRKNPY REDVDLEEER  300
SSKQAAIYSE SPLRTEMFDM VLLCSGGQSP TVALREALKN ASSKTVQQKG QSKGSNGAKG  360
RGKKQSGKKE VVDLRSLLIH CAQAVAADDR RSAHEFLKQI RQHSSPFGDG NQRLAKCFAD  420
GLEARLAGTG SQIYKGFVNK RTSAADILKA YQLYLAACPF RKLSNFTANK TIMSLAQNSM  480
RLHIIDFGIL YGFQWPTFIQ RISMRPGGPP KLRITGIEFP QPGFRPAERV EETGRRLADY  540
AKDFNVPFEY NAIAKRWDTI QLEELKIDRD EVLVVNCLYR AKNLLDETIA VDSSRNIFLN  600
FIRKINPHMF IHGITNGAYN APFFVTRFRE ALFHFSAMFD MLETIVPRED RERMVIEKDI  660
FGREALNVVA CEGWERVERP ETYKQWQVRN LRAGFVQLPL DRDIVKRATD RVRSGYHKDF  720
VIDEDNRWLL QGWKGRIIYA LSAWKPV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-453787458375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Csi.56390.0fruit| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429104.10.0hypothetical protein CICLE_v10011141mg
RefseqXP_006429105.10.0hypothetical protein CICLE_v10011141mg
RefseqXP_006480839.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A067EBD10.0A0A067EBD1_CITSI; Uncharacterized protein
STRINGPOPTR_0006s08690.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein